Toggle menu
14087800908
  • EUR
    • Euro
    • US Dollar
  • LoginorSign Up
  • 0
World Biomedical Frontiers
×
×

    Shop By Category

  • Antibody
    • Antibody
    • IgA Antibody
    • IgE Antibody
    • IgG Antibody
  • Assay Kit
    • Assay Kit
    • Interleukin Assay Kit
  • Biotherapes Products
    • Biotherapes Products
    • Media & Media Supplements
  • Buffer
    • Buffer
    • Western Blot Buffer
  • category
    • category
    • Allergy
    • Alzheimer
    • Anemia
    • Arthritis
    • Autoimmune Disease
    • Cancer
    • Cardiovascular Disease
    • Obesity
    • stem-cells
  • Elisa Grade
  • ICL Antibodies
  • ICL ELISA
  • ICL Isotype Control
  • ICL Loading Control
  • ICL Protein Standard
  • Immunization Grade
  • Oxidative Stress
  • PCR Reagent
    • PCR Reagent
    • Hepatitis Viruses PCR kit
  • Peptide
  • Polyclonal Antibodies
    • Polyclonal Antibodies
    • ELISA Antibodies
    • ICC Antibodies
    • IF Antibodies
    • IHC-p Antibodies
    • IP Antibodies
    • WB Antibodies
  • Research Antibodies
    • Research Antibodies
    • Cancer Antibodies
    • Cardiac Markers Antibodies
    • Cell Biology
    • Cell Cycle
    • Differentiation and Development
    • DNA and RNA
    • Drugs and Toxicology
    • Growth Factors
    • Hormones and Steroids
    • Immunology
    • Infectious Disease
    • Miscellaneous
    • Neuroscience
    • Nutrition and Metabolism
    • Proteases and Enzymes
    • Protein Modification
    • Research Antibodies
    • Signal Transduction
  • Shop All
  • T-Cell Grade
  • Publications
  • Utility
  • Shop By Brand

  • ELK Biotechnology
  • Fitzgerald Gentaur
  • Immunology Consultant Laboratory
  • Chondrex
  • Akron Gentaur
  • Sacace Biotechnologies
  • View all Brands
  • Content Pages

  • About us
    • About us
    • biomedfrontiers.org
  • Home
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Understanding Allergies: Types, Symptoms, and Management Strategies
    • The Interplay Between Obesity and Diabetes: Mechanisms and Management Strategies
    • Understanding Arthritis: Types, Symptoms, and Treatment Options
    • The Promise of Stem Cells: A Journey into Regenerative Medicine
    • Targeting Tumor Microenvironment: Harnessing the Power of Immune Cells in Cancer Therapy
    • Progress in Autoimmune Diseases Research
    • Hypertension
      • Hypertension
      • hypertension artérielle
      • PRESSION ARTÉRIELLE, RISQUE CARDIOVASCULAIRE ET RÉNAL
      • Ventricular-vascular coupling in hypertension
      • Prescription d’un traitement antihypertenseur
    • Infection Disease
      • Infection Disease
      • Arthritis Research
      • Microbiology
      • Handwashing
      • Disinfection methods
      • Isolation or transmission-based precautions
      • Basic principles of immunization
      • The six targeted diseases
      • inf-2016-3-21
      • Progress towards meeting EPI targets
      • infection-2013-11-3
      • infection-2013-11-53
      • infection-2013-12-20
      • infection-2013-12-8
      • infection-2013-nov
      • infection-2014-4-11
      • infection-2014-5-32
      • infection-2014-5-33
      • infection-2014-6-10
      • Investigating dielectric properties of different stages of syngeneic murine ovarian cancer cells.
    • Allergy
      • Allergy
      • allergy-2013-11-14
      • 8-Oxoguanine DNA glycosylase-1-mediated DNA repair is associated with Rho GTPase activation and α-smooth muscle actin polymerization.
      • Airway hyper-responsiveness to mannitol provides a good evaluation of atopy in childhood asthma.
      • A novel intranasal therapy of azelastine with fluticasone for the treatment of allergic rhinitis.
      • C1 inhibitor function using contact-phase proteases as target: evaluation of an innovative assay.
      • Are sputum eosinophil cationic protein and eosinophils differently associated with clinical and functional findings of asthma?
      • Clinical Parameters vs Cytokine Profiles as Predictive Markers of IgE-Mediated Allergy in Young Children.
      • Asthma-predictive-index, bronchial-challenge, sputum eosinophils in acutely wheezing preschoolers
      • Evaluation of two commercial omalizumab/free IgE immunoassays: implications of use during therapy.
      • Biomarkers of Oxidative Stress in Acute and Chronic Bronchial Asthma
      • Expression of genes related to anti-inflammatory pathways are modified among farmers’ children.
      • Flavonoids for Allergic Diseases: Present Evidence and Future Perspective.
      • Chlamydia pneumoniae-Specific IgE Is Prevalent in Asthma and Is Associated with Disease Severity
      • Hereditary angioedema: molecular and clinical differences among European populations.
      • Clinically significant variability of serum IgE concentrations in patients with severe asthma.
      • High Prevalence of Nickel Allergy in an Overweight Female Population: A Pilot Observational Analysis
      • Development of an Assay Method to Search for Compounds Inhibiting Stress-Enhanced Allergy.
      • IL-37 requires IL-18Rα and SIGIRR/IL-1R8 to diminish allergic airway inflammation in mice
      • Implementing asthma guidelines using practice facilitation and local learning collaboratives: a randomized controlled trial.
      • Disruption of Heat Shock Protein 90 (Hsp90)-Protein Kinase Cδ (PKCδ) Interaction by (-)-Maackiain Suppresses Histamine H1 Receptor Gene Transcription in HeLa Cells.
      • Induction of Oral Tolerance with Transgenic Plants Expressing Antigens for Prevention/Treatment of Autoimmune, Allergic and Inflammatory Diseases
      • FCER2 (CD23) asthma-related single nucleotide polymorphisms yields increased IgE binding and Egr-1 expression in human B cells.
      • Inflammatory marker sTREM-1 reflects the clinical stage and respiratory tract obstruction in allergic asthma bronchiale patients and correlates with number of neutrophils.
      • Fenretinide prevents inflammation and airway hyperresponsiveness in a mouse model of allergic asthma.
      • Inhaled Cissampelos sympodialis Down-Regulates Airway Allergic Reaction by Reducing Lung CD3+T Cells.
      • Glucocorticoids Reset the Nasal Circadian Clock in Mice.
      • Metabolomic Endotype of Asthma.
      • Inhibition of CD23-mediated IgE transcytosis suppresses the initiation and development of allergic airway inflammation.
      • Misidentification of airflow obstruction: prevalence and clinical significance in an epidemiological study
      • Interferon regulatory factor 7 is a major hub connecting interferon-mediated responses in virus-induced asthma exacerbations in vivo.
      • Reversibility after inhaling salbutamol in different body postures in asthmatic children: a pilot study.
      • KCNQ (Kv7) potassium channel activators as bronchodilators: combination with a β2-adrenergic agonist enhances relaxation of rat airways.
      • Serum high-sensitivity C-reactive protein can be an airway inflammation predictor in bronchial asthma.
      • Linking Endotoxins, African Dust PM10 and Asthma in an Urban and Rural Environment of Puerto Rico
      • SMAD Signaling in the Airways of Healthy Rhesus Macaques versus Rhesus Macaques with Asthma Highlights a Relationship Between Inflammation and Bone Morphogenetic Proteins.
      • Lung remodeling in a mouse model of asthma involves a balance between TGF-β1 and BMP-7.
      • Targeted Delivery of siRNA to Activated T Cells via Transferrin-Polyethylenimine (Tf-PEI) as a Potential Therapy of Asthma
      • N-acetylcysteine exerts therapeutic action in a rat model of allergic rhinitis.
      • No Concentration Decrease of House Dust Mite Allergens With Rising Altitude in Alpine Regions
      • Plasma vitamin D and serum total immunoglobulin E levels in patients with seasonal allergic conjunctivitis.
      • Prevention of intestinal allergy in mice by rflaA:Ova is associated with enforced antigen processing and TLR5-dependent IL-10 secretion by mDC
      • Secondary soy allergy in children with birch pollen allergy may cause both chronic and acute symptoms.
      • Signal relay by CC chemokine receptor 2 (CCR2) and formylpeptide receptor 2 (Fpr2) in the recruitment of monocyte-derived dendritic cells in allergic airway inflammation.
      • Sputum cytokine mapping reveals an ‘IL-5, IL-17A, IL-25-high’ pattern associated with poorly controlled asthma.
      • The antagonism of histamine H1 and H4 receptors ameliorates chronic allergic dermatitis via anti-pruritic and anti-inflammatory effects in NC/Nga mice.
      • The association between childhood asthma and adult chronic obstructive pulmonary disease.
      • The effects of the novel SHIP1 activator AQX-1125 on allergen-induced responses in mild-to-moderate asthma.
      • Tolerance-like mediated suppression by mesenchymal stem cells in dust mite allergic asthma.
      • Tranilast, an orally active antiallergic compound, inhibits extracellular matrix production in human uterine leiomyoma and myometrial cells.
    • Alzheimer
      • Alzheimer
      • alzheimer-2013-11-3
      • alzheimer-2014-12-25
      • alzheimer-2015-5-22
      • alzheimer-2015-5-24
      • alzheimer-2015-7-3
      • neuro-2016-10-16
      • neuro-2016-17
      • Allopregnanolone endogenous neurosteroid
      • neuro-2016-9-10
      • neuro-2016-9-2
      • subcortical-brain-alterations-in-major-depressive-disorder-findings-from-the-enigma-major-depressive-disorder-working-group
      • Aβ Forty-Two INducers (AFTINs), low MW compounds triggering robust production of Aβ42 and down-regulation of Aβ38 in cell cultures.
      • Alzheimer’s disease and co-morbidity: Increased prevalence and possible risk factors of excess mortality in a naturalistic 7-year follow-up
      • Association of the Variant Cys139Arg at GRN Gene to the Clinical Spectrum of Frontotemporal Lobar Degeneration
      • Astroglial heme oxygenase-1 and the origin of corpora amylacea in aging and degenerating neural tissues.
      • Concentration of donepezil to the cognitive response in Alzheimer disease.
      • Confrontation Naming Errors in Alzheimer’s Disease
      • Davunetide: Peptide therapeutic in neurological disorders.
      • Delayed audiovisual integration of patients with mild cognitive impairment and Alzheimer’s disease compared with normal aged controls.
      • Dihydromyricetin ameliorates behavioral deficits and reverses neuropathology of transgenic mouse models of Alzheimer’s disease.
      • Distinct patterns of antiamyloid-β antibodies in typical and atypical Alzheimer disease.
      • Early intervention in the 3xTg-AD mice with an amyloid β-antibody fragment ameliorates first hallmarks of Alzheimer disease
      • EEG upper/low alpha frequency power ratio and the impulsive disorders network in subjects with mild cognitive impairment.
      • Frontal white matter integrity in adults with Down syndrome with and without dementia.
      • Fungal infection in patients with Alzheimer’s disease.
      • GSK3β, CREB, and BDNF in peripheral blood of patients with Alzheimer’s disease and depression.
      • HDAC6 inhibitor blocks amyloid beta-induced impairment of mitochondrial transport in hippocampal neurons.
      • High-mobility group box-1 protein and β-amyloid oligomers promote neuronal differentiation of adult hippocampal neural progenitors via receptor for advanced glycation end products/nuclear factor-κB axis: relevance for Alzheimer’s disease.
      • Indazole- and indole-5-carboxamides: selective and reversible monoamine oxidase B inhibitors with subnanomolar potency.
      • Involvement of TRPV4 channels in Aβ40-induced hippocampal cell death and astrocytic Ca2+ signalling
      • NeuroDNet – an open source platform for constructing and analyzing neurodegenerative disease networks.
      • Neuroinflammation and complexes of 17β-hydroxysteroid dehydrogenase type 10–amyloid β in Alzheimer’s disease.
      • Neuroscience Biomedical Frontiers
      • Ordered subset analysis of copy number variation association with age at onset of Alzheimer’s disease.
      • Proteomic Analysis of Serum Proteins in Triple Transgenic Alzheimer’s Disease Mice: Implications for Identifying Biomarkers for Use to Screen Potential Candidate Therapeutic Drugs for Early AD
      • Rare coding variants in the phospholipase D3 gene confer risk for Alzheimer’s disease.
      • Sleep-state related EEG amplitude distribution in the rat model of cortical cholinergic innervation disorder.
      • Targeting nanoparticles across the blood-brain barrier with monoclonal antibodies.
      • The Notch intracellular domain represses CRE-dependent transcription.
      • Troy, a tumor necrosis factor receptor family member, interacts with lgr5 to inhibit wnt signaling in intestinal stem cells.
      • Tyr682 in the Aβ-precursor protein intracellular domain regulates synaptic connectivity, cholinergic function, and cognitive performance.
      • Widespread neuron-specific transgene expression in brain and spinal cord following synapsin promoter-driven AAV9 neonatal intracerebroventricular injection.
      • Hemorrhagic stroke incidence is declining faster than ischemic stroke in Joinville, Brazil: A population-based study over 18 years and systematic review
      • Is Period3 genotype associated with sleep and recovery in patients with disorder of consciousness?
      • Subcortical brain alterations in major depressive disorder: findings from the ENIGMA Major Depressive Disorder working group.
      • The spacing principle for unlearning abnormal neuronal synchrony
      • High rate of magnetic resonance imaging Alzheimer recurrence in cryptogenic transient ischemic attack and minor Alzheimer patients.
    • Anemia
      • Anemia
      • anemia-2013-july-4
      • Automated reticulocyte parameters for hereditary spherocytosis screening.
      • Changes in iron transporter divalent metal transporter 1 in proximal jejunum after gastric bypass.
      • Diabetes mellitus and advanced liver fibrosis are risk factors for severe anaemia during telaprevir-based triple therapy.
      • Early propranolol administration to severely injured patients can improve bone marrow dysfunction.
      • Ferrous bisglycinate 25 mg iron is as effective as ferrous sulfate 50 mg iron in the prophylaxis of iron deficiency and anemia during pregnancy in a randomized trial.
      • Inappropriate expression of hepcidin by liver congestion contributes to anemia and relative iron deficiency.
      • Increased basal oxidation of peroxiredoxin 2 and limited peroxiredoxin recycling in glucose-6-phosphate dehydrogenase-deficient erythrocytes from newborn infants.
      • Iron status of pregnant Indian women from an area of active iron supplementation.
      • Positive effect of large birth intervals on early childhood hemoglobin levels in Africa is limited to girls. Cross-sectional DHS study
      • Predictors of iron levels in 14,737 Danish blood donors: results from the Danish Blood Donor Study.
      • Survival and senescence of human young red cells in vitro.
      • Observation-to-imitate plus practice could add little to physical therapy benefits within 31 days of stroke: translational randomized controlled trial.
    • Arthritis
    • Autoimmune disease
      • Autoimmune disease
      • A Case of Stiff Person Syndrome: Immunomodulatory Effect of Benzodiazepines: Successful Rituximab and Tizanidine Therapy.
      • Aptamer BC007 for neutralization of pathogenic autoantibodies directed against G-protein coupled receptors: A vision of future treatment of patients with cardiomyopathies and positivity for those autoantibodies.
      • Chronic exposure to water pollutant trichloroethylene increased epigenetic drift in CD4+ T cells
      • Effect of a family history of psoriasis and age on comorbidities and quality of life in patients with moderate to severe psoriasis: Results from the ARIZONA study.
      • Experimental autoimmune encephalomyelitis and age-related correlations of NADPH oxidase, MMP-9, and cell adhesion molecules: The increased disease severity and blood-brain barrier permeability in middle-aged mice.
      • Glycomacropeptide is a prebiotic that reduces Desulfovibrio bacteria, increases cecal short-chain fatty acids, and is anti-inflammatory in mice.
      • Home-based training to improve manual dexterity in patients with multiple sclerosis: A randomized controlled trial
      • Metagenomic Analysis of Crohn’s Disease Patients Identifies Changes in the Virome and Microbiome Related to Disease Status and Therapy, and Detects Potential Interactions and Biomarkers.
      • Novel receptor-derived cyclopeptides to treat heart failure caused by anti-β1-adrenoceptor antibodies in a human-analogous rat model.
      • Recovery from experimental autoimmune uveitis promotes induction of antiuveitic inducible Tregs.
    • Breacking News
      • Breacking News
      • ep-2016-10
      • ep-20173-1
      • ep-20173-21
      • ep-20173-6
      • World Biomedical frontiers Breakthrought New Tech
      • newtech-2016-10-21
      • Breakthroughs of the year 2007
      • Breakthroughs of the year 2006
      • Breakthroughs og 2013
      • Breakthroughs of the year 2008
      • Breakthroughs of the year 2009
      • Breakthroughs of the year 2010
      • Blood microRNAs in Low or No Risk Ischemic Stroke Patients.
      • Atrial fibrillation and the risk of ischemic stroke: does it still matter in patients with a CHA2DS2-VASc score of 0 or 1?
    • Cancer
      • Cancer
      • cancer-2016-3-7
      • Expression of the receptor for hyaluronic acid mediated motility (RHAMM) is associated with poor prognosis and metastasis in non-small cell lung carcinoma.
      • cancer-2016-6-26
      • Survival of patients with BRCA1-associated breast cancer diagnosed in an MRI-based surveillance program.
      • Aza-Michael Mono-addition Using Acidic Alumina under Solventless Conditions.
      • Cigarette smoke-induced reduction in binding of the salivary translocator protein is not mediated by free radicals.
      • Discovery bioanalysis and in vivo pharmacology as an integrated process: a case study in oncology drug discovery.
      • Evaluation of different extraction methods from pomegranate whole fruit or peels and of the antioxidant and antiproliferative activity of the polyphenolic fraction
      • Histone Methylation by Temozolomide; A Classic DNA Methylating Anticancer Drug
      • How Intrinsic Molecular Dynamics Control Intramolecular Communication in the Signal Transducers and Activators of Transcription Factor STAT5
      • Impact of the New Jersey Breast Density Law on Imaging and Intervention Volumes and Breast Cancer Diagnosis.
      • Improved Treatment of MT-3 Breast Cancer and Brain Metastases in a Mouse Xenograft by LRP-Targeted Oxaliplatin Liposomes
      • L-carnosine dipeptide overcomes acquired resistance to 5-fluorouracil in HT29 human colon cancer cells via downregulation of HIF1-alpha and induction of apoptosis.
      • Low doses of gamma irradiation potentially modifies immunosuppressive tumor microenvironment by retuning tumor-associated macrophages: lesson from insulinoma
      • Mucorales-Specific T Cells in Patients with Hematologic Malignancies.
      • The Bisphenol A analogue Bisphenol S binds to K-Ras4B – implications for ‘BPA-free’ plastics
      • Gene expression changes of interconnected spared cortical neurons 7 days after ischemic infarct of the primary motor cortex in the rat.
      • cancer 201310 9
      • cancer 20139 15
      • Diagnostic Use Of Epitope Detection In Monocytes Blood Test For Early Detection Of Colon Cancer Metastasis
      • Role of the combined CHADS2 score and echocardiographic abnormalities in predicting Cancer in patients with paroxysmal atrial fibrillation.
    • Cardiovascular disease
      • Cardiovascular disease
      • cardio-2015-2
      • Risk of ischemic stroke during the initiation period of α-blocker therapy among older men
      • A Cluster-Randomized, Controlled Trial of a Simplified Multifaceted Management Program for Individuals at High Cardiovascular Risk (SimCard Trial) in Rural Tibet, China, and Haryana, India.
      • Adjuvant-induced mono-arthritis potentiates cerebral hemorrhage in the spontaneously hypertensive rats with increased severity due to high salt diet.
      • An antihypertensive opioid: Biphalin, a synthetic non-addictive enkephalin analog decreases blood pressure in spontaneously hypertensive rats.
      • Antifungal-Associated Drug-Induced Cardiac Disease.
      • Embryonic Exposures of Lithium and Homocysteine and Folate Protection Affect Lipid Metabolism during Mouse Cardiogenesis and Placentation
      • Endogenous Ouabain: An Old Cardiotonic Steroid as a New Biomarker of Heart Failure and a Predictor of Mortality after Cardiac Surgery.
      • Effect of Trimethylamine N-Oxide on Interfacial Electrostatics at Phospholipid Monolayer-Water Interfaces and Its Relevance to Cardiovascular Disease
      • Homoarginine predicts mortality in treatment-naive patients with pulmonary arterial hypertension.
      • Incremental cost-effectiveness of dobutamine stress cardiac magnetic resonance imaging in patients at intermediate risk for coronary artery disease.
      • L-carnitine intake and high trimethylamine N-oxide plasma levels correlate with low aortic lesions in ApoE-/- transgenic mice expressing CETP
      • Lower Squalene Epoxidase and Higher Scavenger Receptor Class B Type 1 Protein Levels Are Involved in Reduced Serum Cholesterol Levels in Stroke-Prone Spontaneously Hypertensive Rats.
      • Pericoronary Adipose Tissue as Storage and Supply Site for Oxidized Low-Density Lipoprotein in Human Coronary Plaques.
      • Role of cerebellar adrenomedullin in blood pressure regulation.
      • Statins in Familial Hypercholesterolemia: Consequences for Coronary Artery Disease and All-Cause Mortality.
      • Hemispheric differences in ischemic stroke: is left-hemisphere stroke more common?
      • Cost-effectiveness analysis of stroke management under a universal health insurance system.
      • The myth of the ‘unaffected’ side after unilateral stroke: is reorganisation of the non-infarcted corticospinal system to re-establish balance the price for recovery?
      • Short-term dose-response characteristics of 2-iminobiotin immediately postinsult in the neonatal piglet after hypoxia-ischemia.
    • faq
      • faq
      • 2011 2
    • Impact factor
    • Muscoskeletal Disorder
      • Muscoskeletal Disorder
      • /osteoporosis-2013-july/
      • osteoporosis-2015-5-5
      • stroke-2013-11-3
      • stroke-2013-july-8
      • Age-Related Effects of Advanced Glycation End Products (Ages) in Bone Matrix on Osteoclastic Resorption
      • Constitutively Elevated Blood Serotonin Is Associated With Bone Loss and Type 2 Diabetes in Rats
      • Differential sclerostin and parathyroid hormone response to exercise in boys and men.
      • Effects of Active Mastication on Chronic Stress-Induced Bone Loss in Mice.
      • Femoral Strength Changes Faster With Age Than BMD in Both Women and Men: A Biomechanical Study.
      • Genome-Wide Chromatin Landscape Transitions Identify Novel Pathways in Early Commitment to Osteoblast Differentiation.
      • GLP-1 receptor agonist treatment increases bone formation and prevents bone loss in weight-reduced obese women
      • Late-Onset Hypogonadism and Testosterone Replacement in Older Men.
      • arthritis 2013 july 1
    • Obesity
      • Obesity
      • the association of molecular lipid species with changes in BMI
      • A comparison of independent ROC curves
      • Article The Association between Branched-Chain Amino Acids (BCAAs) and Cardiometabolic Risk Factors in Middle-Aged Caucasian Women Stratified According to Glycemic Status
      • History of CVD, diabetes mellitus type 1
      • Obesity, insulin resistance and diabete
      • Physician-diagnosed diabetes and the use of glucose-lowering medications for diabeteso
      • The cardiometabolic effects of BCAAs
      • the development of full-blown type 2 diabetes
      • The serum insulin concentration for TC, LDL-C HDL-C, TG, creatinine, CRP, gamma glutamyltransferase (GGT), total calcium, and albumin, and the plasma
      • A clinical study which relates to a theoretical simulation of the glucose transport in the human placenta under various diabetic conditions.
      • An apolipoprotein B100 mimotope prevents obesity in mice.
      • Association of endothelial proliferation with the magnitude of weight loss during calorie restriction.
      • Biomolecular Characterization of Putative Antidiabetic Herbal Extracts.
      • Featured Article: Inhibition of diabetic cataract by glucose tolerance factor extracted from yeast.
      • Mea6 controls VLDL transport through the coordinated regulation of COPII assembly.
      • Metforminium Decavanadate as a Potential Metallopharmaceutical Drug for the Treatment of Diabetes Mellitus.
      • Relationship between the efficacy of oral antidiabetic drugs and clinical features in type 2 diabetic patients (JDDM38).
      • Whole-grain pasta reduces appetite and meal-induced thermogenesis acutely: a pilot study.
      • diabetes 2013 aug 11
    • Stem Cells
      • Stem Cells
      • stem-cells-2015-10-11
      • stem-cells-2013-11-10
      • stem-cells-2015-5-14
      • stem-cells-2015-5-21
      • stem-cells-2015-5-24
      • stem-cells-2015-7-3
      • Accumulation of DNA damage-induced chromatin alterations in tissue-specific stem cells: the driving force of aging?
      • Are human dental papilla-derived stem cell and human brain-derived neural stem cell transplantation suitable for treatment of Parkinson’s disease?
      • Assessment of a preclinical model for studying the survival and engraftment of human stem cell derived osteogenic cell populations following orthotopic implantation.
      • Epigenetic switching by the metabolism-sensing factors in the generation of orexin neurons from mouse embryonic stem cells.
      • Haploidentical hematopoietic stem cell transplantation for lymphoma with monosomy of chromosome 6 (loss of heterozygosity in the HLA region)–who should be a donor?
      • Improved cell therapy protocols for Parkinson’s disease based on differentiation efficiency and safety of hESC-, hiPSC-, and non-human primate iPSC-derived dopaminergic neurons.
      • Lineage mapping and characterization of the native progenitor population in cellular allograft.
      • Mesenchymal stromal cell atrophy in coculture increases aggressiveness of transformed cells.
      • Most methylation-susceptible DNA sequences in human embryonic stem cells undergo a change in conformation or flexibility upon methylation.
      • Ovarian cancer stem cells are enriched in side population and aldehyde dehydrogenase bright overlapping population.
      • Adaptive redox response of mesenchymal stromal cells to stimulation with lipopolysaccharide inflammagen: mechanisms of remodeling of tissue barriers in sepsis. Oxid
      • Adverse effect of demineralized bone powder on osteogenesis of human mesenchymal stem cells.
      • An opposite effect of the CDK inhibitor, p18INK4c on embryonic stem cells compared with tumor and adult stem cells.
      • Awakened by cellular stress: isolation and characterization of a novel population of pluripotent stem cells derived from human adipose tissue.
      • Cancer stem cell markers are associated with adverse biomarker profiles and molecular subtypes of breast cancer.
      • Characterization of in vitro expanded bone marrow-derived mesenchymal stem cells isolated from experimental autoimmune encephalomyelitis mice.
      • Chondrogenic differentiation of immortalized human mesenchymal stem cells on zirconia microwell substrata.
      • Common chromosomal imbalances and stemness-related protein expression markers in endometriotic lesions from different anatomical sites: the potential role of stem cells.
      • Confined 3D microenvironment regulates early differentiation in human pluripotent stem cells.
      • Decidua mesenchymal stem cells migrated toward mammary tumors in vitro and in vivo affecting tumor growth and tumor development.
      • Differentiation of CD133+ stem cells from amyotrophic lateral sclerosis patients into preneuron cells.
      • Differentiation of Human Adipose-Derived Stem Cells into Fat Involves Reactive Oxygen Species and Forkhead Box O1 Mediated Upregulation of Antioxidant Enzymes.
      • Differentiation of human stem cells is promoted by amphiphilic pluronic block copolymers.
      • Early versus delayed autologous stem cell transplant in patients receiving novel therapies for multiple myeloma.
      • Electromagnetic fields enhance chondrogenesis of human adipose-derived stem cells in a chondrogenic microenvironment in vitro.
      • Encephalitozoon intestinalis: A Rare Cause of Diarrhea in an Allogeneic Hematopoietic stem cell Transplantation (HSCT) Recipient Complicated by Albendazole-Related Hepatotoxicity.
      • Enhanced Osteoblastogenesis of Adipose-Derived Stem Cells on Spermine Delivery via β-Catenin Activation.
      • Epigenetic regulation of SOX9 by the NF-κB signaling pathway in pancreatic cancer stem cells.
      • Estradiol promotes neural stem cell differentiation into endothelial lineage and angiogenesis in injured peripheral nerve.
      • Evidences of early senescence in multiple myeloma bone marrow mesenchymal stromal cells.
      • Exogenous activation of BMP-2 signaling overcomes TGFβ-mediated inhibition of osteogenesis in Marfan embryonic stem cells and Marfan patient-specific induced pluripotent stem cells.
      • Fractal organization of the human T cell repertoire in health and after stem cell transplantation.
      • Generation of neural cells from DM1 induced pluripotent stem cells as cellular model for the study of central nervous system neuropathogenesis.
      • Histone deacetylase inhibitors stimulate dedifferentiation of human breast cancer cells through WNT/β-catenin signaling.
      • Identification and characterization of a transient outward K+ current in human induced pluripotent stem cell-derived cardiomyocytes.
      • IMD-0354 targets breast cancer stem cells: a novel approach for an adjuvant to chemotherapy to prevent multidrug resistance in a murine model.
      • Immunohistochemical and gene expression analysis of stem-cell-associated markers in rat dental pulp.
      • Impact of different mesenchymal stromal cell types on T-cell activation, proliferation and migration.
      • Impact of socioeconomic status on initial clinical presentation to a memory disorders clinic.
      • In situ electrostimulation drives a regenerative shift in the zone of infarcted myocardium.
      • In vitro assessment of mesenchymal stem cells immunosuppressive potential in multiple sclerosis patients.
      • Intra-articular injection of human mesenchymal stem cells (MSCs) promote rat meniscal regeneration by being activated to express Indian hedgehog that enhances expression of type II collagen.
      • Intracoronary Infusion of Autologous CD133(+) Cells in Myocardial Infarction and Tracing by Tc99m MIBI Scintigraphy of the Heart Areas Involved in Cell Homing.
      • ITO/gold nanoparticle/RGD peptide composites to enhance electrochemical signals and proliferation of human neural stem cells.
      • Mechanotransduction in cancer stem cells.
      • Mesenchymal stem cells isolated from peripheral blood and umbilical cord Wharton’s jelly.
      • Mesenchymal stem cells – a promising perspective in the orofacial cleft surgery.
      • Mesenchymal stromal cells primed with Paclitaxel attract and kill leukaemia cells, inhibit angiogenesis and improve survival of leukaemia-bearing mice.
      • Modulation of glucose and lipid metabolism by porcine adiponectin receptor 1-transgenic mesenchymal stromal cells in diet-induced obese mice.
      • Monitoring neurodegeneration in diabetes using adult neural stem cells derived from the olfactory bulb.
      • N-acetylcysteine enhances neuronal differentiation of P19 embryonic stem cells via Akt and N-cadherin activation.
      • Neural progenitors derived from human induced pluripotent stem cells survive and differentiate upon transplantation into a rat model of amyotrophic lateral sclerosis.
      • Neurotrophic factor-secreting autologous muscle stem cell therapy for the treatment of laryngeal denervation injury.
      • NKX2-1 activation by SMAD2 signaling after definitive endoderm differentiation in human embryonic stem cell.
      • No ethical bypass of moral status in stem cell research.
      • pecificity and heterogeneity of terahertz radiation effect on gene expression in mouse mesenchymal stem cells.
      • Production of functional classical brown adipocytes from human pluripotent stem cells using specific hemopoietin cocktail without gene transfer.
      • Promotion of spinal cord regeneration by neural stem cell-secreted trimerized cell adhesion molecule L1.
      • Regenerative potential of decellularized porcine nucleus pulposus hydrogel scaffolds: stem cell differentiation, matrix remodeling, and biocompatibility studies.
      • Regulation of neural stem cell differentiation by transcription factors HNF4-1 and MAZ-1.
      • Regulation of osteogenic differentiation of human adipose-derived stem cells by controlling electromagnetic field conditions.
      • Sequential differentiation of mesenchymal stem cells in an agarose scaffold promotes a physis-like zonal alignment of chondrocytes.
      • Severe limbal stem cell deficiency from contact lens wear: patient clinical features.
      • Stem cells versus donor specific transfusions for tolerance induction in living donor renal transplantation: a single-center experience.
      • The effect of rabbit antithymocyte globulin on human mesenchymal stem cells.
      • The impact of culture on epigenetic properties of pluripotent stem cells and pre-implantation embryos.
      • The opposite effects of doxorubicin on bone marrow stem cells versus breast cancer stem cells depend on glucosylceramide synthase.
      • The stem-cell profile of ovarian surface epithelium is reproduced in the oviductal fimbriae, with increased stem-cell marker density in distal parts of the fimbriae.
      • Three-dimensional structural niches engineered via two-photon laser polymerization promote stem cell homing.
      • Treating spinal cord injury in rats with a combination of human fetal neural stem cells and hydrogels modified with serotonin.
      • Valproic acid confers functional pluripotency to human amniotic fluid stem cells in a transgene-free approach.
      • Breakdown of Epithelial Barrier Integrity and Overdrive Activation of Alveolar Epithelial Cells in the Pathogenesis of Acute Respiratory Distress Syndrome and Lung Fibrosis.
      • Cartilage repair by human umbilical cord blood-derived mesenchymal stem cells with different hydrogels in a rat model.
      • Evaluation of the effect of adipose tissue-derived stem cells on the quality of bone healing around implants.
      • Expanded Hematopoietic Progenitor Cells Reselected for High Aldehyde Dehydrogenase Activity Demonstrate Islet Regenerative Functions.
      • Expression of genes related to germ cell lineage and pluripotency in single cells and colonies of human adult germ stem cells
      • Live fluorescent RNA-based detection of pluripotency gene expression in embryonic and induced pluripotent stem cells of different species.
      • SETD7 Regulates the Differentiation of Human Embryonic Stem Cells
      • Highly efficient mesenchymal stem cell proliferation on poly-ε-caprolactone nanofibers with embedded magnetic nanoparticles
      • Murine Embryonic Stem Cell Plasticity Is Regulated through Klf5 and Maintained by Metalloproteinase MMP1 and Hypoxia.
  • User Navigation

    • EUR
      • Euro
      • US Dollar
  • LoginorSign Up
×
  • About us
    • About us
    • biomedfrontiers.org
  • Home
  • Shipping & Returns
  • Contact Us
  • Blog
    • Blog
    • Understanding Allergies: Types, Symptoms, and Management Strategies
    • The Interplay Between Obesity and Diabetes: Mechanisms and Management Strategies
    • Understanding Arthritis: Types, Symptoms, and Treatment Options
    • The Promise of Stem Cells: A Journey into Regenerative Medicine
    • Targeting Tumor Microenvironment: Harnessing the Power of Immune Cells in Cancer Therapy
    • Progress in Autoimmune Diseases Research
    • Hypertension
      • Hypertension
      • hypertension artérielle
      • PRESSION ARTÉRIELLE, RISQUE CARDIOVASCULAIRE ET RÉNAL
      • Ventricular-vascular coupling in hypertension
      • Prescription d’un traitement antihypertenseur
    • Infection Disease
      • Infection Disease
      • Arthritis Research
      • Microbiology
      • Handwashing
      • Disinfection methods
      • Isolation or transmission-based precautions
      • Basic principles of immunization
      • The six targeted diseases
      • inf-2016-3-21
      • Progress towards meeting EPI targets
      • infection-2013-11-3
      • infection-2013-11-53
      • infection-2013-12-20
      • infection-2013-12-8
      • infection-2013-nov
      • infection-2014-4-11
      • infection-2014-5-32
      • infection-2014-5-33
      • infection-2014-6-10
      • Investigating dielectric properties of different stages of syngeneic murine ovarian cancer cells.
    • Allergy
      • Allergy
      • allergy-2013-11-14
      • 8-Oxoguanine DNA glycosylase-1-mediated DNA repair is associated with Rho GTPase activation and α-smooth muscle actin polymerization.
      • Airway hyper-responsiveness to mannitol provides a good evaluation of atopy in childhood asthma.
      • A novel intranasal therapy of azelastine with fluticasone for the treatment of allergic rhinitis.
      • C1 inhibitor function using contact-phase proteases as target: evaluation of an innovative assay.
      • Are sputum eosinophil cationic protein and eosinophils differently associated with clinical and functional findings of asthma?
      • Clinical Parameters vs Cytokine Profiles as Predictive Markers of IgE-Mediated Allergy in Young Children.
      • Asthma-predictive-index, bronchial-challenge, sputum eosinophils in acutely wheezing preschoolers
      • Evaluation of two commercial omalizumab/free IgE immunoassays: implications of use during therapy.
      • Biomarkers of Oxidative Stress in Acute and Chronic Bronchial Asthma
      • Expression of genes related to anti-inflammatory pathways are modified among farmers’ children.
      • Flavonoids for Allergic Diseases: Present Evidence and Future Perspective.
      • Chlamydia pneumoniae-Specific IgE Is Prevalent in Asthma and Is Associated with Disease Severity
      • Hereditary angioedema: molecular and clinical differences among European populations.
      • Clinically significant variability of serum IgE concentrations in patients with severe asthma.
      • High Prevalence of Nickel Allergy in an Overweight Female Population: A Pilot Observational Analysis
      • Development of an Assay Method to Search for Compounds Inhibiting Stress-Enhanced Allergy.
      • IL-37 requires IL-18Rα and SIGIRR/IL-1R8 to diminish allergic airway inflammation in mice
      • Implementing asthma guidelines using practice facilitation and local learning collaboratives: a randomized controlled trial.
      • Disruption of Heat Shock Protein 90 (Hsp90)-Protein Kinase Cδ (PKCδ) Interaction by (-)-Maackiain Suppresses Histamine H1 Receptor Gene Transcription in HeLa Cells.
      • Induction of Oral Tolerance with Transgenic Plants Expressing Antigens for Prevention/Treatment of Autoimmune, Allergic and Inflammatory Diseases
      • FCER2 (CD23) asthma-related single nucleotide polymorphisms yields increased IgE binding and Egr-1 expression in human B cells.
      • Inflammatory marker sTREM-1 reflects the clinical stage and respiratory tract obstruction in allergic asthma bronchiale patients and correlates with number of neutrophils.
      • Fenretinide prevents inflammation and airway hyperresponsiveness in a mouse model of allergic asthma.
      • Inhaled Cissampelos sympodialis Down-Regulates Airway Allergic Reaction by Reducing Lung CD3+T Cells.
      • Glucocorticoids Reset the Nasal Circadian Clock in Mice.
      • Metabolomic Endotype of Asthma.
      • Inhibition of CD23-mediated IgE transcytosis suppresses the initiation and development of allergic airway inflammation.
      • Misidentification of airflow obstruction: prevalence and clinical significance in an epidemiological study
      • Interferon regulatory factor 7 is a major hub connecting interferon-mediated responses in virus-induced asthma exacerbations in vivo.
      • Reversibility after inhaling salbutamol in different body postures in asthmatic children: a pilot study.
      • KCNQ (Kv7) potassium channel activators as bronchodilators: combination with a β2-adrenergic agonist enhances relaxation of rat airways.
      • Serum high-sensitivity C-reactive protein can be an airway inflammation predictor in bronchial asthma.
      • Linking Endotoxins, African Dust PM10 and Asthma in an Urban and Rural Environment of Puerto Rico
      • SMAD Signaling in the Airways of Healthy Rhesus Macaques versus Rhesus Macaques with Asthma Highlights a Relationship Between Inflammation and Bone Morphogenetic Proteins.
      • Lung remodeling in a mouse model of asthma involves a balance between TGF-β1 and BMP-7.
      • Targeted Delivery of siRNA to Activated T Cells via Transferrin-Polyethylenimine (Tf-PEI) as a Potential Therapy of Asthma
      • N-acetylcysteine exerts therapeutic action in a rat model of allergic rhinitis.
      • No Concentration Decrease of House Dust Mite Allergens With Rising Altitude in Alpine Regions
      • Plasma vitamin D and serum total immunoglobulin E levels in patients with seasonal allergic conjunctivitis.
      • Prevention of intestinal allergy in mice by rflaA:Ova is associated with enforced antigen processing and TLR5-dependent IL-10 secretion by mDC
      • Secondary soy allergy in children with birch pollen allergy may cause both chronic and acute symptoms.
      • Signal relay by CC chemokine receptor 2 (CCR2) and formylpeptide receptor 2 (Fpr2) in the recruitment of monocyte-derived dendritic cells in allergic airway inflammation.
      • Sputum cytokine mapping reveals an ‘IL-5, IL-17A, IL-25-high’ pattern associated with poorly controlled asthma.
      • The antagonism of histamine H1 and H4 receptors ameliorates chronic allergic dermatitis via anti-pruritic and anti-inflammatory effects in NC/Nga mice.
      • The association between childhood asthma and adult chronic obstructive pulmonary disease.
      • The effects of the novel SHIP1 activator AQX-1125 on allergen-induced responses in mild-to-moderate asthma.
      • Tolerance-like mediated suppression by mesenchymal stem cells in dust mite allergic asthma.
      • Tranilast, an orally active antiallergic compound, inhibits extracellular matrix production in human uterine leiomyoma and myometrial cells.
    • Alzheimer
      • Alzheimer
      • alzheimer-2013-11-3
      • alzheimer-2014-12-25
      • alzheimer-2015-5-22
      • alzheimer-2015-5-24
      • alzheimer-2015-7-3
      • neuro-2016-10-16
      • neuro-2016-17
      • Allopregnanolone endogenous neurosteroid
      • neuro-2016-9-10
      • neuro-2016-9-2
      • subcortical-brain-alterations-in-major-depressive-disorder-findings-from-the-enigma-major-depressive-disorder-working-group
      • Aβ Forty-Two INducers (AFTINs), low MW compounds triggering robust production of Aβ42 and down-regulation of Aβ38 in cell cultures.
      • Alzheimer’s disease and co-morbidity: Increased prevalence and possible risk factors of excess mortality in a naturalistic 7-year follow-up
      • Association of the Variant Cys139Arg at GRN Gene to the Clinical Spectrum of Frontotemporal Lobar Degeneration
      • Astroglial heme oxygenase-1 and the origin of corpora amylacea in aging and degenerating neural tissues.
      • Concentration of donepezil to the cognitive response in Alzheimer disease.
      • Confrontation Naming Errors in Alzheimer’s Disease
      • Davunetide: Peptide therapeutic in neurological disorders.
      • Delayed audiovisual integration of patients with mild cognitive impairment and Alzheimer’s disease compared with normal aged controls.
      • Dihydromyricetin ameliorates behavioral deficits and reverses neuropathology of transgenic mouse models of Alzheimer’s disease.
      • Distinct patterns of antiamyloid-β antibodies in typical and atypical Alzheimer disease.
      • Early intervention in the 3xTg-AD mice with an amyloid β-antibody fragment ameliorates first hallmarks of Alzheimer disease
      • EEG upper/low alpha frequency power ratio and the impulsive disorders network in subjects with mild cognitive impairment.
      • Frontal white matter integrity in adults with Down syndrome with and without dementia.
      • Fungal infection in patients with Alzheimer’s disease.
      • GSK3β, CREB, and BDNF in peripheral blood of patients with Alzheimer’s disease and depression.
      • HDAC6 inhibitor blocks amyloid beta-induced impairment of mitochondrial transport in hippocampal neurons.
      • High-mobility group box-1 protein and β-amyloid oligomers promote neuronal differentiation of adult hippocampal neural progenitors via receptor for advanced glycation end products/nuclear factor-κB axis: relevance for Alzheimer’s disease.
      • Indazole- and indole-5-carboxamides: selective and reversible monoamine oxidase B inhibitors with subnanomolar potency.
      • Involvement of TRPV4 channels in Aβ40-induced hippocampal cell death and astrocytic Ca2+ signalling
      • NeuroDNet – an open source platform for constructing and analyzing neurodegenerative disease networks.
      • Neuroinflammation and complexes of 17β-hydroxysteroid dehydrogenase type 10–amyloid β in Alzheimer’s disease.
      • Neuroscience Biomedical Frontiers
      • Ordered subset analysis of copy number variation association with age at onset of Alzheimer’s disease.
      • Proteomic Analysis of Serum Proteins in Triple Transgenic Alzheimer’s Disease Mice: Implications for Identifying Biomarkers for Use to Screen Potential Candidate Therapeutic Drugs for Early AD
      • Rare coding variants in the phospholipase D3 gene confer risk for Alzheimer’s disease.
      • Sleep-state related EEG amplitude distribution in the rat model of cortical cholinergic innervation disorder.
      • Targeting nanoparticles across the blood-brain barrier with monoclonal antibodies.
      • The Notch intracellular domain represses CRE-dependent transcription.
      • Troy, a tumor necrosis factor receptor family member, interacts with lgr5 to inhibit wnt signaling in intestinal stem cells.
      • Tyr682 in the Aβ-precursor protein intracellular domain regulates synaptic connectivity, cholinergic function, and cognitive performance.
      • Widespread neuron-specific transgene expression in brain and spinal cord following synapsin promoter-driven AAV9 neonatal intracerebroventricular injection.
      • Hemorrhagic stroke incidence is declining faster than ischemic stroke in Joinville, Brazil: A population-based study over 18 years and systematic review
      • Is Period3 genotype associated with sleep and recovery in patients with disorder of consciousness?
      • Subcortical brain alterations in major depressive disorder: findings from the ENIGMA Major Depressive Disorder working group.
      • The spacing principle for unlearning abnormal neuronal synchrony
      • High rate of magnetic resonance imaging Alzheimer recurrence in cryptogenic transient ischemic attack and minor Alzheimer patients.
    • Anemia
      • Anemia
      • anemia-2013-july-4
      • Automated reticulocyte parameters for hereditary spherocytosis screening.
      • Changes in iron transporter divalent metal transporter 1 in proximal jejunum after gastric bypass.
      • Diabetes mellitus and advanced liver fibrosis are risk factors for severe anaemia during telaprevir-based triple therapy.
      • Early propranolol administration to severely injured patients can improve bone marrow dysfunction.
      • Ferrous bisglycinate 25 mg iron is as effective as ferrous sulfate 50 mg iron in the prophylaxis of iron deficiency and anemia during pregnancy in a randomized trial.
      • Inappropriate expression of hepcidin by liver congestion contributes to anemia and relative iron deficiency.
      • Increased basal oxidation of peroxiredoxin 2 and limited peroxiredoxin recycling in glucose-6-phosphate dehydrogenase-deficient erythrocytes from newborn infants.
      • Iron status of pregnant Indian women from an area of active iron supplementation.
      • Positive effect of large birth intervals on early childhood hemoglobin levels in Africa is limited to girls. Cross-sectional DHS study
      • Predictors of iron levels in 14,737 Danish blood donors: results from the Danish Blood Donor Study.
      • Survival and senescence of human young red cells in vitro.
      • Observation-to-imitate plus practice could add little to physical therapy benefits within 31 days of stroke: translational randomized controlled trial.
    • Arthritis
    • Autoimmune disease
      • Autoimmune disease
      • A Case of Stiff Person Syndrome: Immunomodulatory Effect of Benzodiazepines: Successful Rituximab and Tizanidine Therapy.
      • Aptamer BC007 for neutralization of pathogenic autoantibodies directed against G-protein coupled receptors: A vision of future treatment of patients with cardiomyopathies and positivity for those autoantibodies.
      • Chronic exposure to water pollutant trichloroethylene increased epigenetic drift in CD4+ T cells
      • Effect of a family history of psoriasis and age on comorbidities and quality of life in patients with moderate to severe psoriasis: Results from the ARIZONA study.
      • Experimental autoimmune encephalomyelitis and age-related correlations of NADPH oxidase, MMP-9, and cell adhesion molecules: The increased disease severity and blood-brain barrier permeability in middle-aged mice.
      • Glycomacropeptide is a prebiotic that reduces Desulfovibrio bacteria, increases cecal short-chain fatty acids, and is anti-inflammatory in mice.
      • Home-based training to improve manual dexterity in patients with multiple sclerosis: A randomized controlled trial
      • Metagenomic Analysis of Crohn’s Disease Patients Identifies Changes in the Virome and Microbiome Related to Disease Status and Therapy, and Detects Potential Interactions and Biomarkers.
      • Novel receptor-derived cyclopeptides to treat heart failure caused by anti-β1-adrenoceptor antibodies in a human-analogous rat model.
      • Recovery from experimental autoimmune uveitis promotes induction of antiuveitic inducible Tregs.
    • Breacking News
      • Breacking News
      • ep-2016-10
      • ep-20173-1
      • ep-20173-21
      • ep-20173-6
      • World Biomedical frontiers Breakthrought New Tech
      • newtech-2016-10-21
      • Breakthroughs of the year 2007
      • Breakthroughs of the year 2006
      • Breakthroughs og 2013
      • Breakthroughs of the year 2008
      • Breakthroughs of the year 2009
      • Breakthroughs of the year 2010
      • Blood microRNAs in Low or No Risk Ischemic Stroke Patients.
      • Atrial fibrillation and the risk of ischemic stroke: does it still matter in patients with a CHA2DS2-VASc score of 0 or 1?
    • Cancer
      • Cancer
      • cancer-2016-3-7
      • Expression of the receptor for hyaluronic acid mediated motility (RHAMM) is associated with poor prognosis and metastasis in non-small cell lung carcinoma.
      • cancer-2016-6-26
      • Survival of patients with BRCA1-associated breast cancer diagnosed in an MRI-based surveillance program.
      • Aza-Michael Mono-addition Using Acidic Alumina under Solventless Conditions.
      • Cigarette smoke-induced reduction in binding of the salivary translocator protein is not mediated by free radicals.
      • Discovery bioanalysis and in vivo pharmacology as an integrated process: a case study in oncology drug discovery.
      • Evaluation of different extraction methods from pomegranate whole fruit or peels and of the antioxidant and antiproliferative activity of the polyphenolic fraction
      • Histone Methylation by Temozolomide; A Classic DNA Methylating Anticancer Drug
      • How Intrinsic Molecular Dynamics Control Intramolecular Communication in the Signal Transducers and Activators of Transcription Factor STAT5
      • Impact of the New Jersey Breast Density Law on Imaging and Intervention Volumes and Breast Cancer Diagnosis.
      • Improved Treatment of MT-3 Breast Cancer and Brain Metastases in a Mouse Xenograft by LRP-Targeted Oxaliplatin Liposomes
      • L-carnosine dipeptide overcomes acquired resistance to 5-fluorouracil in HT29 human colon cancer cells via downregulation of HIF1-alpha and induction of apoptosis.
      • Low doses of gamma irradiation potentially modifies immunosuppressive tumor microenvironment by retuning tumor-associated macrophages: lesson from insulinoma
      • Mucorales-Specific T Cells in Patients with Hematologic Malignancies.
      • The Bisphenol A analogue Bisphenol S binds to K-Ras4B – implications for ‘BPA-free’ plastics
      • Gene expression changes of interconnected spared cortical neurons 7 days after ischemic infarct of the primary motor cortex in the rat.
      • cancer 201310 9
      • cancer 20139 15
      • Diagnostic Use Of Epitope Detection In Monocytes Blood Test For Early Detection Of Colon Cancer Metastasis
      • Role of the combined CHADS2 score and echocardiographic abnormalities in predicting Cancer in patients with paroxysmal atrial fibrillation.
    • Cardiovascular disease
      • Cardiovascular disease
      • cardio-2015-2
      • Risk of ischemic stroke during the initiation period of α-blocker therapy among older men
      • A Cluster-Randomized, Controlled Trial of a Simplified Multifaceted Management Program for Individuals at High Cardiovascular Risk (SimCard Trial) in Rural Tibet, China, and Haryana, India.
      • Adjuvant-induced mono-arthritis potentiates cerebral hemorrhage in the spontaneously hypertensive rats with increased severity due to high salt diet.
      • An antihypertensive opioid: Biphalin, a synthetic non-addictive enkephalin analog decreases blood pressure in spontaneously hypertensive rats.
      • Antifungal-Associated Drug-Induced Cardiac Disease.
      • Embryonic Exposures of Lithium and Homocysteine and Folate Protection Affect Lipid Metabolism during Mouse Cardiogenesis and Placentation
      • Endogenous Ouabain: An Old Cardiotonic Steroid as a New Biomarker of Heart Failure and a Predictor of Mortality after Cardiac Surgery.
      • Effect of Trimethylamine N-Oxide on Interfacial Electrostatics at Phospholipid Monolayer-Water Interfaces and Its Relevance to Cardiovascular Disease
      • Homoarginine predicts mortality in treatment-naive patients with pulmonary arterial hypertension.
      • Incremental cost-effectiveness of dobutamine stress cardiac magnetic resonance imaging in patients at intermediate risk for coronary artery disease.
      • L-carnitine intake and high trimethylamine N-oxide plasma levels correlate with low aortic lesions in ApoE-/- transgenic mice expressing CETP
      • Lower Squalene Epoxidase and Higher Scavenger Receptor Class B Type 1 Protein Levels Are Involved in Reduced Serum Cholesterol Levels in Stroke-Prone Spontaneously Hypertensive Rats.
      • Pericoronary Adipose Tissue as Storage and Supply Site for Oxidized Low-Density Lipoprotein in Human Coronary Plaques.
      • Role of cerebellar adrenomedullin in blood pressure regulation.
      • Statins in Familial Hypercholesterolemia: Consequences for Coronary Artery Disease and All-Cause Mortality.
      • Hemispheric differences in ischemic stroke: is left-hemisphere stroke more common?
      • Cost-effectiveness analysis of stroke management under a universal health insurance system.
      • The myth of the ‘unaffected’ side after unilateral stroke: is reorganisation of the non-infarcted corticospinal system to re-establish balance the price for recovery?
      • Short-term dose-response characteristics of 2-iminobiotin immediately postinsult in the neonatal piglet after hypoxia-ischemia.
    • faq
      • faq
      • 2011 2
    • Impact factor
    • Muscoskeletal Disorder
      • Muscoskeletal Disorder
      • /osteoporosis-2013-july/
      • osteoporosis-2015-5-5
      • stroke-2013-11-3
      • stroke-2013-july-8
      • Age-Related Effects of Advanced Glycation End Products (Ages) in Bone Matrix on Osteoclastic Resorption
      • Constitutively Elevated Blood Serotonin Is Associated With Bone Loss and Type 2 Diabetes in Rats
      • Differential sclerostin and parathyroid hormone response to exercise in boys and men.
      • Effects of Active Mastication on Chronic Stress-Induced Bone Loss in Mice.
      • Femoral Strength Changes Faster With Age Than BMD in Both Women and Men: A Biomechanical Study.
      • Genome-Wide Chromatin Landscape Transitions Identify Novel Pathways in Early Commitment to Osteoblast Differentiation.
      • GLP-1 receptor agonist treatment increases bone formation and prevents bone loss in weight-reduced obese women
      • Late-Onset Hypogonadism and Testosterone Replacement in Older Men.
      • arthritis 2013 july 1
    • Obesity
      • Obesity
      • the association of molecular lipid species with changes in BMI
      • A comparison of independent ROC curves
      • Article The Association between Branched-Chain Amino Acids (BCAAs) and Cardiometabolic Risk Factors in Middle-Aged Caucasian Women Stratified According to Glycemic Status
      • History of CVD, diabetes mellitus type 1
      • Obesity, insulin resistance and diabete
      • Physician-diagnosed diabetes and the use of glucose-lowering medications for diabeteso
      • The cardiometabolic effects of BCAAs
      • the development of full-blown type 2 diabetes
      • The serum insulin concentration for TC, LDL-C HDL-C, TG, creatinine, CRP, gamma glutamyltransferase (GGT), total calcium, and albumin, and the plasma
      • A clinical study which relates to a theoretical simulation of the glucose transport in the human placenta under various diabetic conditions.
      • An apolipoprotein B100 mimotope prevents obesity in mice.
      • Association of endothelial proliferation with the magnitude of weight loss during calorie restriction.
      • Biomolecular Characterization of Putative Antidiabetic Herbal Extracts.
      • Featured Article: Inhibition of diabetic cataract by glucose tolerance factor extracted from yeast.
      • Mea6 controls VLDL transport through the coordinated regulation of COPII assembly.
      • Metforminium Decavanadate as a Potential Metallopharmaceutical Drug for the Treatment of Diabetes Mellitus.
      • Relationship between the efficacy of oral antidiabetic drugs and clinical features in type 2 diabetic patients (JDDM38).
      • Whole-grain pasta reduces appetite and meal-induced thermogenesis acutely: a pilot study.
      • diabetes 2013 aug 11
    • Stem Cells
      • Stem Cells
      • stem-cells-2015-10-11
      • stem-cells-2013-11-10
      • stem-cells-2015-5-14
      • stem-cells-2015-5-21
      • stem-cells-2015-5-24
      • stem-cells-2015-7-3
      • Accumulation of DNA damage-induced chromatin alterations in tissue-specific stem cells: the driving force of aging?
      • Are human dental papilla-derived stem cell and human brain-derived neural stem cell transplantation suitable for treatment of Parkinson’s disease?
      • Assessment of a preclinical model for studying the survival and engraftment of human stem cell derived osteogenic cell populations following orthotopic implantation.
      • Epigenetic switching by the metabolism-sensing factors in the generation of orexin neurons from mouse embryonic stem cells.
      • Haploidentical hematopoietic stem cell transplantation for lymphoma with monosomy of chromosome 6 (loss of heterozygosity in the HLA region)–who should be a donor?
      • Improved cell therapy protocols for Parkinson’s disease based on differentiation efficiency and safety of hESC-, hiPSC-, and non-human primate iPSC-derived dopaminergic neurons.
      • Lineage mapping and characterization of the native progenitor population in cellular allograft.
      • Mesenchymal stromal cell atrophy in coculture increases aggressiveness of transformed cells.
      • Most methylation-susceptible DNA sequences in human embryonic stem cells undergo a change in conformation or flexibility upon methylation.
      • Ovarian cancer stem cells are enriched in side population and aldehyde dehydrogenase bright overlapping population.
      • Adaptive redox response of mesenchymal stromal cells to stimulation with lipopolysaccharide inflammagen: mechanisms of remodeling of tissue barriers in sepsis. Oxid
      • Adverse effect of demineralized bone powder on osteogenesis of human mesenchymal stem cells.
      • An opposite effect of the CDK inhibitor, p18INK4c on embryonic stem cells compared with tumor and adult stem cells.
      • Awakened by cellular stress: isolation and characterization of a novel population of pluripotent stem cells derived from human adipose tissue.
      • Cancer stem cell markers are associated with adverse biomarker profiles and molecular subtypes of breast cancer.
      • Characterization of in vitro expanded bone marrow-derived mesenchymal stem cells isolated from experimental autoimmune encephalomyelitis mice.
      • Chondrogenic differentiation of immortalized human mesenchymal stem cells on zirconia microwell substrata.
      • Common chromosomal imbalances and stemness-related protein expression markers in endometriotic lesions from different anatomical sites: the potential role of stem cells.
      • Confined 3D microenvironment regulates early differentiation in human pluripotent stem cells.
      • Decidua mesenchymal stem cells migrated toward mammary tumors in vitro and in vivo affecting tumor growth and tumor development.
      • Differentiation of CD133+ stem cells from amyotrophic lateral sclerosis patients into preneuron cells.
      • Differentiation of Human Adipose-Derived Stem Cells into Fat Involves Reactive Oxygen Species and Forkhead Box O1 Mediated Upregulation of Antioxidant Enzymes.
      • Differentiation of human stem cells is promoted by amphiphilic pluronic block copolymers.
      • Early versus delayed autologous stem cell transplant in patients receiving novel therapies for multiple myeloma.
      • Electromagnetic fields enhance chondrogenesis of human adipose-derived stem cells in a chondrogenic microenvironment in vitro.
      • Encephalitozoon intestinalis: A Rare Cause of Diarrhea in an Allogeneic Hematopoietic stem cell Transplantation (HSCT) Recipient Complicated by Albendazole-Related Hepatotoxicity.
      • Enhanced Osteoblastogenesis of Adipose-Derived Stem Cells on Spermine Delivery via β-Catenin Activation.
      • Epigenetic regulation of SOX9 by the NF-κB signaling pathway in pancreatic cancer stem cells.
      • Estradiol promotes neural stem cell differentiation into endothelial lineage and angiogenesis in injured peripheral nerve.
      • Evidences of early senescence in multiple myeloma bone marrow mesenchymal stromal cells.
      • Exogenous activation of BMP-2 signaling overcomes TGFβ-mediated inhibition of osteogenesis in Marfan embryonic stem cells and Marfan patient-specific induced pluripotent stem cells.
      • Fractal organization of the human T cell repertoire in health and after stem cell transplantation.
      • Generation of neural cells from DM1 induced pluripotent stem cells as cellular model for the study of central nervous system neuropathogenesis.
      • Histone deacetylase inhibitors stimulate dedifferentiation of human breast cancer cells through WNT/β-catenin signaling.
      • Identification and characterization of a transient outward K+ current in human induced pluripotent stem cell-derived cardiomyocytes.
      • IMD-0354 targets breast cancer stem cells: a novel approach for an adjuvant to chemotherapy to prevent multidrug resistance in a murine model.
      • Immunohistochemical and gene expression analysis of stem-cell-associated markers in rat dental pulp.
      • Impact of different mesenchymal stromal cell types on T-cell activation, proliferation and migration.
      • Impact of socioeconomic status on initial clinical presentation to a memory disorders clinic.
      • In situ electrostimulation drives a regenerative shift in the zone of infarcted myocardium.
      • In vitro assessment of mesenchymal stem cells immunosuppressive potential in multiple sclerosis patients.
      • Intra-articular injection of human mesenchymal stem cells (MSCs) promote rat meniscal regeneration by being activated to express Indian hedgehog that enhances expression of type II collagen.
      • Intracoronary Infusion of Autologous CD133(+) Cells in Myocardial Infarction and Tracing by Tc99m MIBI Scintigraphy of the Heart Areas Involved in Cell Homing.
      • ITO/gold nanoparticle/RGD peptide composites to enhance electrochemical signals and proliferation of human neural stem cells.
      • Mechanotransduction in cancer stem cells.
      • Mesenchymal stem cells isolated from peripheral blood and umbilical cord Wharton’s jelly.
      • Mesenchymal stem cells – a promising perspective in the orofacial cleft surgery.
      • Mesenchymal stromal cells primed with Paclitaxel attract and kill leukaemia cells, inhibit angiogenesis and improve survival of leukaemia-bearing mice.
      • Modulation of glucose and lipid metabolism by porcine adiponectin receptor 1-transgenic mesenchymal stromal cells in diet-induced obese mice.
      • Monitoring neurodegeneration in diabetes using adult neural stem cells derived from the olfactory bulb.
      • N-acetylcysteine enhances neuronal differentiation of P19 embryonic stem cells via Akt and N-cadherin activation.
      • Neural progenitors derived from human induced pluripotent stem cells survive and differentiate upon transplantation into a rat model of amyotrophic lateral sclerosis.
      • Neurotrophic factor-secreting autologous muscle stem cell therapy for the treatment of laryngeal denervation injury.
      • NKX2-1 activation by SMAD2 signaling after definitive endoderm differentiation in human embryonic stem cell.
      • No ethical bypass of moral status in stem cell research.
      • pecificity and heterogeneity of terahertz radiation effect on gene expression in mouse mesenchymal stem cells.
      • Production of functional classical brown adipocytes from human pluripotent stem cells using specific hemopoietin cocktail without gene transfer.
      • Promotion of spinal cord regeneration by neural stem cell-secreted trimerized cell adhesion molecule L1.
      • Regenerative potential of decellularized porcine nucleus pulposus hydrogel scaffolds: stem cell differentiation, matrix remodeling, and biocompatibility studies.
      • Regulation of neural stem cell differentiation by transcription factors HNF4-1 and MAZ-1.
      • Regulation of osteogenic differentiation of human adipose-derived stem cells by controlling electromagnetic field conditions.
      • Sequential differentiation of mesenchymal stem cells in an agarose scaffold promotes a physis-like zonal alignment of chondrocytes.
      • Severe limbal stem cell deficiency from contact lens wear: patient clinical features.
      • Stem cells versus donor specific transfusions for tolerance induction in living donor renal transplantation: a single-center experience.
      • The effect of rabbit antithymocyte globulin on human mesenchymal stem cells.
      • The impact of culture on epigenetic properties of pluripotent stem cells and pre-implantation embryos.
      • The opposite effects of doxorubicin on bone marrow stem cells versus breast cancer stem cells depend on glucosylceramide synthase.
      • The stem-cell profile of ovarian surface epithelium is reproduced in the oviductal fimbriae, with increased stem-cell marker density in distal parts of the fimbriae.
      • Three-dimensional structural niches engineered via two-photon laser polymerization promote stem cell homing.
      • Treating spinal cord injury in rats with a combination of human fetal neural stem cells and hydrogels modified with serotonin.
      • Valproic acid confers functional pluripotency to human amniotic fluid stem cells in a transgene-free approach.
      • Breakdown of Epithelial Barrier Integrity and Overdrive Activation of Alveolar Epithelial Cells in the Pathogenesis of Acute Respiratory Distress Syndrome and Lung Fibrosis.
      • Cartilage repair by human umbilical cord blood-derived mesenchymal stem cells with different hydrogels in a rat model.
      • Evaluation of the effect of adipose tissue-derived stem cells on the quality of bone healing around implants.
      • Expanded Hematopoietic Progenitor Cells Reselected for High Aldehyde Dehydrogenase Activity Demonstrate Islet Regenerative Functions.
      • Expression of genes related to germ cell lineage and pluripotency in single cells and colonies of human adult germ stem cells
      • Live fluorescent RNA-based detection of pluripotency gene expression in embryonic and induced pluripotent stem cells of different species.
      • SETD7 Regulates the Differentiation of Human Embryonic Stem Cells
      • Highly efficient mesenchymal stem cell proliferation on poly-ε-caprolactone nanofibers with embedded magnetic nanoparticles
      • Murine Embryonic Stem Cell Plasticity Is Regulated through Klf5 and Maintained by Metalloproteinase MMP1 and Hypoxia.
  • Home
  • Research Antibodies
  • Signal Transduction
  • Synaptophysin 2 antibody
  • Synaptophysin 2 antibody
  • Synaptophysin 2 antibody

    Synaptophysin 2 antibody

    Fitzgerald Gentaur

    MSRP:
    Now: €0.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    70R-14932
    Size:
    200 ug
    Concentration:
    1 mg/ml
    Shipping Information:
    *Blue Ice*
    Applications:
    IHC, WB

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List

    Share This Article

    • Overview
    • Reviews

    Product Description

    Synaptophysin 2 antibody is available at Gentaur for Next Week Delivery.

    Product Description: Affinity purified goat polyclonal TLR8 antibody

    Product Type: Primary Antibodies

    Product Subtype: Purified Polyclonal Antibodies

    Research Area: Signal Transduction

    Immunogen: TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen

    Host: Goat

    Specificity: N/A

    Cross Reactivity: N/A

    Isotype: N/A

    Clone: N/A

    Protein Type: N/A

    Grade and Purity: >90% pure

    Method of Purification: TLR8 antibody was purified by affinity chromatography

    Form and Buffer: Supplied in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

    Storage Information: Aliquot and freeze at -20 deg C. Avoid freeze-thaw cycles

    Usage Recommendations: IHC: 1: 125, WB: 1: 500

    Product Videos

    Custom Field

    Size 200 ug
    Concentration 1 mg/ml
    Shipping Information *Blue Ice*
    Applications IHC, WB

    Product Reviews

    Write a Review

    Write a Review

    ×
    Synaptophysin 2 antibody
    Fitzgerald Gentaur
    Synaptophysin 2 antibody

    ×

    Recommended

    • Synaptophysin antibody Synaptophysin antibody Synaptophysin antibody Synaptophysin antibody
      Quick view Details

      Fitzgerald Gentaur

      |

      sku: 10-1521

      Synaptophysin antibody

      MSRP:
      Now: €154.04
      Add to Cart
    • Presenilin 2 antibody Presenilin 2 antibody Presenilin 2 antibody Presenilin 2 antibody
      Quick view Details

      Fitzgerald Gentaur

      |

      sku: 70R-13083

      Presenilin 2 antibody

      MSRP:
      Now: €330.68
      Add to Cart
    • Desmoglein 2 antibody Desmoglein 2 antibody Desmoglein 2 antibody Desmoglein 2 antibody
      Quick view Details

      Fitzgerald Gentaur

      |

      sku: 10R-5225

      Desmoglein 2 antibody

      MSRP:
      Now: €441.59
      Add to Cart
    • Transglutaminase 2 antibody Transglutaminase 2 antibody Transglutaminase 2 antibody Transglutaminase 2 antibody
      Quick view Details

      Fitzgerald Gentaur

      |

      sku: 20R-2904

      Transglutaminase 2 antibody

      MSRP:
      Now: €230.04
      Add to Cart
    • Fibulin 2 antibody Fibulin 2 antibody
      Quick view Details

      Fitzgerald Gentaur

      |

      sku: 10R-5970

      Fibulin 2 antibody

      MSRP:
      Now: €441.59
      Add to Cart
    ×

    Join Our Mailing List for special offers!


    Contact Us

    6017 Snell AveSan Jose, CA 95123, USA

    Account

    • Wishlist
    • Login or Sign Up
    • Shipping & Returns

    Navigate

    • About us
    • Home
    • Shipping & Returns
    • Contact Us
    • Blog

    Recent Blog Posts

    • Understanding Autoimmune Diseases: A Basic Overview
    • Neuroscience Biomedical Frontiers
    • Impact Of Socioeconomic Status On Initial Clinical Presentation
    • Impact Of Socioeconomic Status On Initial Clinical Presentation To A Memory Disorders Clinic.
    • Survival Of Patients With BRCA1-Associated Breast Cancer
    • © World Biomedical Frontiers |
    • Sitemap |
    • Premium BigCommerce Theme by Lone Star Templates