Product Description
Synaptophysin 2 antibody is available at Gentaur for Next Week Delivery.
Product Description: Affinity purified goat polyclonal TLR8 antibody
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Signal Transduction
Immunogen: TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen
Host: Goat
Specificity: N/A
Cross Reactivity: N/A
Isotype: N/A
Clone: N/A
Protein Type: N/A
Grade and Purity: >90% pure
Method of Purification: TLR8 antibody was purified by affinity chromatography
Form and Buffer: Supplied in 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide
Storage Information: Aliquot and freeze at -20 deg C. Avoid freeze-thaw cycles
Usage Recommendations: IHC: 1: 125, WB: 1: 500
Euro
US Dollar